PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009608176.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 636aa    MW: 70465.6 Da    PI: 4.5675
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009608176.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.35.9e-53281561128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lp+G+rF+Ptdeelv++yL+ k++g + e+ +vi+evdi+k+ePwdLp +  v+++++ew+fF+++d+ky++g+r nrat++gyWkatgkd++++
  XP_009608176.1  28 LPVGYRFRPTDEELVNHYLRLKINGADSEV-SVIREVDICKLEPWDLPdMsVVESNDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIV 121
                     799************************999.99**************96347788999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +kkg+++g+kktLv+y grap+g++t+Wv+heyr+
  XP_009608176.1 122 TKKGAKIGMKKTLVYYIGRAPEGKRTHWVIHEYRA 156
                     *********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-5923179IPR003441NAC domain
PROSITE profilePS5100555.89428179IPR003441NAC domain
PfamPF023651.4E-2629155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MMAVLPGDNV IAVLPVDKQM GIPPLNTLPV GYRFRPTDEE LVNHYLRLKI NGADSEVSVI  60
REVDICKLEP WDLPDMSVVE SNDNEWFFFC PKDRKYQNGQ RLNRATERGY WKATGKDRNI  120
VTKKGAKIGM KKTLVYYIGR APEGKRTHWV IHEYRATDKS LDGSHPGQGA FVLCRLFRKN  180
DLKQDEHVES SNLDDAELNA TVAKSPTEGD LSEAATPLAV IQPLSDSDKS YAAKLPKGEM  240
YGKQLPIESH SNSCIADDTE DQMLDITSIP PDMELEKALG NFCDPSMQPF DWKIFSPLHS  300
QLQVELGSSY LQNPMNNGIG AYQKDVQFQY GTNAFDINEF LDSVIINSDE FSCEDSGQEL  360
VAQFCSVPGA PIKDSGSCSE SEAEVTQRLV EPDFFEPEVL LGNFDREIAV KREVNSIGAT  420
VQEACGSAPY VSNDHAMGNL DFFQHSYPGQ NVYPAGYGAI QVPNFPSVEQ SGGYSNVVSS  480
DSGSGTGIKL RPRQMQNQSD DRQFRTQGTA NRRIRLQMKL QVGRVESRSH TDSSQGPESR  540
LAVTEAEKDS DEHSSSTSDE TRDTTCGEYG VSGEADDLST PVKDACDSPV QDIVDVSLRT  600
NTKLSSSSRL YMSMVLVVVS LLVVFIGVWE CFRVRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-442718416170NO APICAL MERISTEM PROTEIN
1ut4_B3e-442718416170NO APICAL MERISTEM PROTEIN
1ut7_A3e-442718416170NO APICAL MERISTEM PROTEIN
1ut7_B3e-442718416170NO APICAL MERISTEM PROTEIN
3swm_A3e-442718419173NAC domain-containing protein 19
3swm_B3e-442718419173NAC domain-containing protein 19
3swm_C3e-442718419173NAC domain-containing protein 19
3swm_D3e-442718419173NAC domain-containing protein 19
3swp_A3e-442718419173NAC domain-containing protein 19
3swp_B3e-442718419173NAC domain-containing protein 19
3swp_C3e-442718419173NAC domain-containing protein 19
3swp_D3e-442718419173NAC domain-containing protein 19
4dul_A3e-442718416170NAC domain-containing protein 19
4dul_B3e-442718416170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAPTransfer from AT3G49530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4375240.0KF437524.1 Nicotiana benthamiana putative membrane bound NAC transcription factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608176.10.0PREDICTED: uncharacterized protein LOC104102223
TrEMBLU5PZF70.0U5PZF7_NICBE; Putative membrane bound NAC transcription factor 1
STRINGPGSC0003DMT4000014980.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.11e-86NAC domain containing protein 62